PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORUFI08G24040.7
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MIKC_MADS
Protein Properties Length: 207aa    MW: 23403.1 Da    PI: 10.2743
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORUFI08G24040.7genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF100.27.8e-32959151
                     S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
           SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                     krienk+nrqvtf+kRrng+lKKA+ELSvLCdaeva+iifs++gklye++s
  ORUFI08G24040.7  9 KRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCS 59
                     79***********************************************96 PP

2K-box45.82.6e-16701122669
            K-box  26 keienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskK 69 
                      k+++++++  R+llGedL+sL +keL++Le+qL++slk++R+++
  ORUFI08G24040.7  70 KQLSKIEK-VRNLLGEDLDSLGIKELESLEKQLDSSLKHVRTTR 112
                      34455555.5*******************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006633.389161IPR002100Transcription factor, MADS-box
SMARTSM004321.3E-41160IPR002100Transcription factor, MADS-box
CDDcd002655.85E-39265No hitNo description
SuperFamilySSF554555.62E-31279IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004046.0E-33323IPR002100Transcription factor, MADS-box
PfamPF003191.7E-261057IPR002100Transcription factor, MADS-box
PRINTSPR004046.0E-332338IPR002100Transcription factor, MADS-box
PRINTSPR004046.0E-333859IPR002100Transcription factor, MADS-box
PROSITE profilePS512978.22355165IPR002487Transcription factor, K-box
PfamPF014862.3E-1177120IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 207 aa     Download sequence    Send to blast
MGRGRVELKR IENKINRQVT FAKRRNGLLK KAYELSVLCD AEVALIIFSN RGKLYEFCST  60
QRNAVTQDPK QLSKIEKVRN LLGEDLDSLG IKELESLEKQ LDSSLKHVRT TRWILNSDET  120
SRRPRSPATL PPPVPTPLHD RAAAQQQQQQ LARRGDGEME MVPLLLLPST TFLFFENGFP  180
HHHIIILASS TVLALLLVVL VLSSSPF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3mu6_D1e-19265164Myocyte-specific enhancer factor 2A
3mu6_C1e-19265164Myocyte-specific enhancer factor 2A
3mu6_B1e-19265164Myocyte-specific enhancer factor 2A
3mu6_A1e-19265164Myocyte-specific enhancer factor 2A
1egw_D1e-19265164MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_C1e-19265164MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_B1e-19265164MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_A1e-19265164MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1tqe_S2e-19165165Myocyte-specific enhancer factor 2B
1tqe_R2e-19165165Myocyte-specific enhancer factor 2B
1tqe_Q2e-19165165Myocyte-specific enhancer factor 2B
1tqe_P2e-19165165Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126161e-151CP012616.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 8 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015648762.12e-53PREDICTED: MADS-box transcription factor 7 isoform X2
SwissprotP0C5B02e-55MADS7_ORYSI; MADS-box transcription factor 7
SwissprotQ0J4662e-55MADS7_ORYSJ; MADS-box transcription factor 7
TrEMBLA0A0E0QLM51e-151A0A0E0QLM5_ORYRU; Uncharacterized protein
STRINGMLOC_56472.28e-55(Hordeum vulgare)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G24260.35e-47MIKC_MADS family protein